Protein Info for H281DRAFT_01452 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter membrane protein 2, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 64 to 79 (16 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 207 to 232 (26 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 120 to 298 (179 residues), 57.8 bits, see alignment E=6.2e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 91% identity to bxe:Bxe_B2081)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>H281DRAFT_01452 carbohydrate ABC transporter membrane protein 2, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
MNTLSSPLKSAAPHSASKRRRRTAFTPARVGVYLFLLSAALFFLLPLYVMLVTSFKPMSE
IRLGNLLALPAHFTLHAWSAAWESACTGLDCNGIQVGFWNSVRIVVPSTVFSIAIGAVNG
YALSFWRPRGAGVLFGVLLMGAFIPVQVMVYPLVRVLASVHLFSSLPGIVVIHTIFGMPV
MTLLFRNYYASIPQELFKAARIDGGGFWRIFVQLMLPMSTPIIVVAVIMQVTGIWNDFIL
GLVFAGTKNLPMTVQLNNIINTTTGERLYNVNMAATILTSLVPLAVYFISGRWFVRGIAS
GAVKG