Protein Info for H281DRAFT_01451 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter ATP-binding protein, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 64 to 205 (142 residues), 117.4 bits, E=1.5e-37
• PF17912: OB_MalK
  • amino acids 279 to 342 (64 residues), 29.3 bits, E=2.7e-10
• PF08402: TOBE_2
  • amino acids 335 to 407 (73 residues), 28.5 bits, E=2.7e-10

Best Hits

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 82% identity to bxe:Bxe_B2080)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Protein Sequence (415 amino acids)

>H281DRAFT_01451 carbohydrate ABC transporter ATP-binding protein, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
MTYVVKQANTLASPLTGAADMTESADTARTDNMPGVADTADTAHAANVAVRNLTIRLGGN
TVIENLDLDVQPGEFVVLLGPSGCGKSTLLHSIAGLIDVTDGSIEIAGEDMTWADPKDRR
IALVFQSYALYPTMSVERNLSFALRINGTPKAEIARRVARAAEMLQLGPLLKRKPAQLSG
GQRQRVAIGRAIVREADVFLFDEPLSNLDAKLRTELRRELKQLHQRLGATMIYVTHDQVE
AMMLATRMAVMRGGAIQQFGTPAEVYARPANLFVATFLGTPAMNLVNGTLEQRDGALHFC
TEQWRLDVSNYAFVDRSGESQPQSQPQSPPRPCVLGVRAEDVRIGPTQGEGAGEHAKISL
VEPMGNHRVVWLDYHGVQIASIDQSKTPVMPGDTLAFSLDSTHVSLFDAASGARL