Protein Info for H281DRAFT_01448 in Paraburkholderia bryophila 376MFSha3.1

Annotation: high affinity sulphate transporter 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 49 to 73 (25 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 212 to 238 (27 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 389 to 415 (27 residues), see Phobius details PF00916: Sulfate_transp" amino acids 29 to 392 (364 residues), 246 bits, see alignment E=5.9e-77 PF01740: STAS" amino acids 447 to 553 (107 residues), 40.5 bits, see alignment E=2e-14

Best Hits

KEGG orthology group: None (inferred from 90% identity to bug:BC1001_5297)

Predicted SEED Role

"Sulfate permease and related transporters (MFS superfamily)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>H281DRAFT_01448 high affinity sulphate transporter 1 (Paraburkholderia bryophila 376MFSha3.1)
MQDFLGNLATRAGVLKGVLPLSRAAALRDALAGVQLASMDIPQVLGYARIAGMPAVTGLY
TVFLPLIAFAFFGASRHLVVAADSATATIFASRLSTMAPVSSPEYASLAAMVALLTAALL
FVARIFKLGFLADFLSRTVLVGFLAGVGVQVGIAMLGDMLGLTGHAARSVDQLVLVARDW
ARLDVPTIAISVLVVVAVLFFKRVWPRLPVPLIAVVAGIAASDMYGFAARGIAVLGPVAG
GLPPLRMPSVTWEQMLDLVPVAASCFVMIVAQSAAASRVFAERHHEATDTNADLLGIAAA
NAAAAFSGAFVVNGSPTQTAMADRAGTRSQFAQIVFAAVVVVVLLFFSRFLQYLPRCILA
SIVFTIAVGLIDLKTLLAIRRESPGEFALAVFTAAAVVLIGVEHGILVAVALSLLRHVRH
SYRPHTMILAPGDDGVWVPVPAMPGSQTAPGLIVYRFGADLFYANDHFFVDDARRLIDHA
PSTVRWFVVDASAITDLDYSASRSVGELCALLKRSGINVIFARVNPYLRSDMDRHGITPI
IDGSCIFGTLHEALRAAGVDQPVAK