Protein Info for H281DRAFT_01434 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphate:Na+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 57 to 86 (30 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 180 to 206 (27 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 22 to 157 (136 residues), 150.9 bits, see alignment E=2.3e-48 amino acids 177 to 264 (88 residues), 59.5 bits, see alignment E=3.8e-20

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 80% identity to rme:Rmet_1777)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>H281DRAFT_01434 phosphate:Na+ symporter (Paraburkholderia bryophila 376MFSha3.1)
MQPGANLNLIEVVGLLVGGLALFLFGLELMTGGLKAIAGSRLQALLGTLTANRFRGVLAG
AGITALLNSSTITTVLLVGFVSAGLMTLQQSIPVIMGANIGSTLTAQIIAFNISAITPFL
LAGGFLLYGFSRRELVRELGGVLLGLGLLFLGIEFMGNATHPLRNYEPFIAAMQDMRSPL
VGIVIGAVFTAIVQSSAATLAIVIALGSQGLIPLESGIALILGANVGTCGTALLASIGKS
AEAAQVGIVHLLFNLLGVLLLAFVIPQYADFIRQISPSAPELTGAARLAAETPRQAANAH
TVFSVFSTAFLIWFTGPIGKLAQRLAPSKQKGWHDPGVPRYLDDTLVEMPALAISRVQLE
LVSLGKQVENLVNRSATLVVDGSTQTAGTLLDDDKAADTLCTAILTYVGGLSDATHTGDE
GRQLVDLARIATCLDAIREVATTSMLALSERRLAQGADTARLRNAATSRFVTAVIEHFAL
AVRAIAHPEAEVVARILNAKPEIEVLADTARQYMMSELQLQSQEGAVIFRLANDMIEHFN
EVARLSRAIVRASQSLNEVQMPVQM