Protein Info for H281DRAFT_01379 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 195 to 351 (157 residues), 128.8 bits, see alignment E=8.2e-42 PF00990: GGDEF" amino acids 199 to 349 (151 residues), 125.8 bits, see alignment E=1.4e-40 PF00563: EAL" amino acids 389 to 607 (219 residues), 139.2 bits, see alignment E=1.5e-44

Best Hits

KEGG orthology group: None (inferred from 89% identity to bug:BC1001_5329)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (780 amino acids)

>H281DRAFT_01379 diguanylate cyclase/phosphodiesterase (Paraburkholderia bryophila 376MFSha3.1)
MLLTSTQHSSDASLRERFHRRSLEHQRPLSTVTMAFTVVAFLSLVAARAFVGGPAAPLAY
RLGCALVLALLVLAIPRAKSTWTFGAIGVAFSLALVGGLALNVVGLQQPLLWTLPAMVVI
PVCAAPLWLTPTHFFVGSALFYAAAIPLLPGAPRTANVDVVMWMWIAAIGLPTSVVFHFG
FYRFRRNHFLLEDQLAQLAATDPLTGLQNRRAFVAQAERRLADVAQGGEVSAIFLDIDNF
KSLNDRFGHGVGDLALREVAQVLLDGTGGTDSVSRIGGEEFAILLCDGLAGALRLAERLR
GAIAEIERPDGNLTASFGVAEHRSGESIMVLLDRADEALLRAKHSGRNRVCSERPLPQAP
LQSLIEDACGAAGSAGASNSRHRWEDYYLTSHFQPLFSLSHQKQVGFEALLRGELDDGTL
LPPAALFAPKPSNDEGVLDRASHAVHLANARASLPADGWLFLNILPATFVADGYADDLAA
IVRRVGLAPQQVILEILESHGGSVGEMSRAAALYREHGFLIAVDDFGAGQSNLDRLLRIR
PDIVKLDGELIRATSHGTEQPILPKLVSLLHQAGMLVVVEGVETTEELILAVESNVDFAQ
GYLLGRPAAQIVSPGSVHLRIDDAFDMIAQGRAHQHALFESVVEPYRVALREAADALHAG
VAMDRAFSSLATFERCVSCFILDASGRQLGPEVPGPAWSMEGASLHPVANPRDARWDHRP
YYRNAVLLPGVAIASNPYLSLASGRPCIAVTLAAQFADERSVIGVELDWSAQGLPWPARE