Protein Info for H281DRAFT_01376 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 4-oxalomesaconate tautomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 67% identical to GALD_PSEPK: 4-oxalomesaconate tautomerase (galD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09788, hypothetical protein (inferred from 92% identity to bgf:BC1003_5347)

MetaCyc: 67% identical to 4-oxalomesaconate tautomerase (Pseudomonas putida KT2440)
RXN-9983 [EC: 5.3.2.8]

Predicted SEED Role

"FldA protein"

MetaCyc Pathways

gallate degradation I (4/4 steps found)
methylgallate degradation (5/6 steps found)
gallate degradation II (4/5 steps found)
protocatechuate degradation I (meta-cleavage pathway) (6/8 steps found)
superpathway of vanillin and vanillate degradation (7/10 steps found)
syringate degradation (7/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MJF9 at UniProt or InterPro

Protein Sequence (368 amino acids)

>H281DRAFT_01376 4-oxalomesaconate tautomerase (Paraburkholderia bryophila 376MFSha3.1)
MPSRTQTRIPCMMIRGGTSKGAFFMASDLPAEPAERDRVLLAVMGSPDPRQIDGIGGADP
LTSKVAIISPSSREDADVDYLFAQVVVNEARVDFGQNCGNILAGVGPYAIERGLVNAEDG
STRVAIHMVNTGQIAVATVRTPGCRVTYEGDARIDGVPGGAAPIPLEFRDTAGSTCGALL
PTGRLKDTVEGVELTCIDNGMPLVLMRARDLQRTGYETREELDADNELKARIEKIRLVVG
PMMNLGDVSARTVPKMCLVAEPRNGGTISTRSFIPHRCHASIGVLGAVSVATAAVLPGTV
CDGIAKVELEGARKRVSVEHPTGEFTVELTLGGEPERPEVLSAALLRTARWLFDGVVGIP
SSVWEPQV