Protein Info for H281DRAFT_01375 in Paraburkholderia bryophila 376MFSha3.1

Annotation: LysR family transcriptional regulator, regulator for genes of the gallate degradation pathway

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF00126: HTH_1" amino acids 34 to 93 (60 residues), 63.7 bits, see alignment E=1.3e-21 amino acids 136 to 194 (59 residues), 61.9 bits, see alignment E=4.6e-21 PF03466: LysR_substrate" amino acids 220 to 425 (206 residues), 124.6 bits, see alignment E=3.8e-40

Best Hits

KEGG orthology group: None (inferred from 92% identity to bgf:BC1003_5348)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MJ54 at UniProt or InterPro

Protein Sequence (440 amino acids)

>H281DRAFT_01375 LysR family transcriptional regulator, regulator for genes of the gallate degradation pathway (Paraburkholderia bryophila 376MFSha3.1)
MTRDASLVAVRNDAPGKAPAKTTAPASSKDLLNLAQLRAFRLVADMGSATRAAAALFRAQ
SAVTRSVQELESAVGEPLFDRGPSGMLPTPVGRAVLLRCERIFVELEELAQWCAARQARR
RPAAEGALPAYLLNTRRLQIFVALARHRHMPSAAKTFGISQPAVSTAVRVLESGSGLSLF
HRSPRGILLTAEGETFLLHVRRALNELRHVPDDIAALRGNIRGAVTVGALPLGRTLILPK
AIAKLSADNPGVRVVTDESAYEALVAGLRAGDIDFILGALRENDSTSGLKNERLMSEDMV
LLVRRDHPLTRAHEPNIADLRDAQWILPRSHAPARALFEAQFKRMKIKPPLPTVETADLA
VIRGLLLGTDMVAALSAQQLHYEVQAGQLAVLKVPLHNTRREIGLTMRAAGTPSPAARAL
IDAIRLSVVELTRTVSVAAS