Protein Info for H281DRAFT_01329 in Paraburkholderia bryophila 376MFSha3.1

Annotation: prolyl aminopeptidase (EC:3.4.11.5). Serine peptidase. MEROPS family S33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF00561: Abhydrolase_1" amino acids 45 to 314 (270 residues), 89.8 bits, see alignment E=2.4e-29 PF12146: Hydrolase_4" amino acids 46 to 305 (260 residues), 61 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 80% identity to bgf:BC1003_5426)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>H281DRAFT_01329 prolyl aminopeptidase (EC:3.4.11.5). Serine peptidase. MEROPS family S33 (Paraburkholderia bryophila 376MFSha3.1)
MRRPRSATQMHTRMRPQTAPTVHALRTRDAHCVSFTVTGAADGVPVVVLHGGPGSGSQPD
ATRLFDLTRFKVVLIDQRGTGRSTPRGGVRHNRTDRLIEDIEAVRVRLGIERWGVLGGSW
GAALALAYAGRHPQSVTGVVLRGLFLTSAREVRGLFVTSRRRAPHAWAKLCAAARCTQPA
GLLARCAARLRHGRASDASDAQRRALALAWRGYENAVLASASTRRKLVPARSSHKESRKL
VDKYRIQAHYLTHRCWLGATRLLSLARVAGAAGVPLAAVHGSRDPVCPPDNLRRLARAVP
AAHVECVRAGHLASDPALRERVADALAAMFLPSTHEGRTLRCAA