Protein Info for H281DRAFT_01327 in Paraburkholderia bryophila 376MFSha3.1

Annotation: formylmethanofuran dehydrogenase, subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03122: formylmethanofuran dehydrogenase subunit C
  • amino acids 6 to 282 (277 residues), 228.3 bits, E=5e-72
• PF01493: GXGXG
  • amino acids 96 to 221 (126 residues), 45 bits, E=4.9e-16

Best Hits

Swiss-Prot: 41% identical to FHCC_METEA: Formyltransferase/hydrolase complex Fhc subunit C (fhcC) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K00202, formylmethanofuran dehydrogenase subunit C [EC: 1.2.99.5] (inferred from 84% identity to bug:BC1001_3974)

MetaCyc: 41% identical to formyltransferase/hydrolase complex gamma subunit (Methylorubrum extorquens AM1)
RXN-2884

Predicted SEED Role

"Formylmethanofuran dehydrogenase (tungsten) subunit C (EC 1.2.99.5)" in subsystem Methanogenesis (EC 1.2.99.5)

MetaCyc Pathways

• formaldehyde oxidation VI (H₄MPT pathway) (3/4 steps found)
• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• superpathway of C1 compounds oxidation to CO₂ (8/12 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• methoxylated aromatic compound degradation II (5/9 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
• superpathway of methanogenesis (5/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.99.5

Protein Sequence (284 amino acids)

>H281DRAFT_01327 formylmethanofuran dehydrogenase, subunit C (Paraburkholderia bryophila 376MFSha3.1)
MSVVTTLRVRTAPGFRVDASALLPASLAALSIADVERIVLPAGNDSCAVGDVFDVSRSGD
AATSDEAGQGGADCALMIEDAGPWLDRIGARMTQGHLIVSGSAGDQCGLQMAGGVLRIDG
DAGHFTACEMRGGRLTVAGNCGDFAAGALAGDMEGMTGGTLTIHGNAGARLADRMRRGLV
LVGGNAGDFAASRLVAGTIGIAGQLGAHYAYGMRRGTLLLAQRPTSVPPTFTDGGRGFDV
FWSLLVRSLASEIAPFSQWRAARLPRRYAGDVAVDGRGEILVVG