Protein Info for H281DRAFT_01323 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00977: His_biosynth" amino acids 2 to 240 (239 residues), 72.4 bits, see alignment E=2e-24

Best Hits

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 74% identity to bxe:Bxe_B2460)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase related protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MJ18 at UniProt or InterPro

Protein Sequence (248 amino acids)

>H281DRAFT_01323 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (Paraburkholderia bryophila 376MFSha3.1)
MQVIPVLDLLDGHVVRAVRGERTAYLPIRSSLTATSEPLAVARALLVASGARTLYIADLG
AILQRGAHIQTLTALRAALPGIDIWLDAGYADYASMLALFDRIDAGSKPATHDLATLVPV
FGTESLQDPQALHAAETAGLSPLLSLDHRAGQLLTAATPSDISTLTPASWPRRVIAMTLD
QVGSYDGPDLATFERVRATAPAHTDVIGAGGIRHRDDIEAAARTGASAWLVASALHDGRV
GMPLAAST