Protein Info for H281DRAFT_01302 in Paraburkholderia bryophila 376MFSha3.1

Annotation: SSU ribosomal protein S6P modification protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF18030: Rimk_N" amino acids 25 to 121 (97 residues), 38.6 bits, see alignment E=1.6e-13 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 27 to 319 (293 residues), 159.3 bits, see alignment E=6.2e-51 PF08443: RimK" amino acids 126 to 319 (194 residues), 67.1 bits, see alignment E=2.5e-22 PF02955: GSH-S_ATP" amino acids 161 to 284 (124 residues), 34.7 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 87% identity to bgf:BC1003_5454)

Predicted SEED Role

"Possible glutaminyl transferase clustered with tetrahydromethanopterin biosynthesis genes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>H281DRAFT_01302 SSU ribosomal protein S6P modification protein (Paraburkholderia bryophila 376MFSha3.1)
MSLPLPSDSTAMDAGTDTPGAQAPLRIAIMTDETGWHTGRLKKAFRARGAEARCIDLADC
RIDTTWEPHGLVLPGFGHGLPDAVFVRGIAGGTFEQVTLRLGILHALRESGVPVYNDARA
IERSVDKSMTSFLLHRHGVPMPATWAGESAAFAQRVLMREAAAGRQVVLKPLFGSQGHGL
KRLGLRSTPPRALAPLPSLKPYSQVAYLQRFIDGGRPGFDWRVLVIGGRAVAAMRRIGGK
GWIHNFAQGATCEAAELDPALAQTAVRATEALGLDYAGVDLIPDPHDAARPLVLEVNGVA
AWRGLQSVTSIDIAAALADDLLFRKLPAQRGEVAAVVALHGRHG