Protein Info for H281DRAFT_01275 in Paraburkholderia bryophila 376MFSha3.1

Annotation: MFS transporter, AAHS family, 3-hydroxyphenylpropionic acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 58 to 79 (22 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details amino acids 321 to 321 (1 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 262 (233 residues), 120.8 bits, see alignment E=6.7e-39 amino acids 235 to 411 (177 residues), 50.5 bits, see alignment E=1.5e-17 PF00083: Sugar_tr" amino acids 57 to 206 (150 residues), 63.2 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: K05819, MFS transporter, AAHS family, 3-hydroxyphenylpropionic acid transporter (inferred from 93% identity to bgf:BC1003_5484)

Predicted SEED Role

"3-hydroxyphenylpropionic acid transporter" in subsystem Phenylpropanoid compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MN45 at UniProt or InterPro

Protein Sequence (413 amino acids)

>H281DRAFT_01275 MFS transporter, AAHS family, 3-hydroxyphenylpropionic acid transporter (Paraburkholderia bryophila 376MFSha3.1)
MKSTRTALPADGMAQATARTGAAVTLSLCFAVALLEGLDLQSVGVAAPRMAREFGLSVAQ
MGLAFSAGTFGLLPGAMLGGRLADRIGRKRILILCACLFGLLSIATAFVSSFGMLVFVRV
LTGIGLGGALPNLIALSSEAVSPKLRNTAVSVMYCGIPFGGVIASIVGIVSIGDTQWRHI
FYVGGAGPLILVPLLLAFLPESSAFRRVSHGMNAKPAPVGEVLFGGSRGLSTLQIWISYF
CTLIVLYFLLNWLPSLMAARGLARAEVGYVQIFFNIGGGLGALFIGMLMDRLRGGVVVSG
MYIGIIASLAALSIAPGFAALMVSAFFAGMFVIGGQSVLYALSAAFYPTAMRGTGVGAAV
AVGRVGSVVGPLAAGQLLAMGRSSSTVIGASIPVTLIAAAAALMLIRRPRAND