Protein Info for H281DRAFT_01271 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 219 to 381 (163 residues), 126 bits, see alignment E=6.1e-41 PF00990: GGDEF" amino acids 222 to 378 (157 residues), 135.6 bits, see alignment E=6.9e-44

Best Hits

KEGG orthology group: None (inferred from 78% identity to bug:BC1001_3912)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>H281DRAFT_01271 diguanylate cyclase (GGDEF) domain-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MHVDLLTLYLLLIGTLFASSGMTLWEHQSHPRRSRELRVLAAGYATLATGCAAAVFRHDL
PAPWGSALSNLVILTGYLLVLHGAALLNGRRYPAGSLALLLVMALTWAVGGARWESTVWA
YVSAVAIAVASGMTSREFLRSDDFKAFQSRRIAVAVTAIHALFYAFRALVLPWLVTRYGM
GLLPTIGAITMYEGVLYSVILPMTVLKMIREETHGQLLHESQTDYLTRLGNRRWFFEEGM
RVLGEGHESGSVSLLALDLDHFKKLNDRYGHKTGDEVLKSFADVARSVVGREAVLARIGG
EEFAVLLPRHDERRAREVGEAIVRGFAQTVSHRVDGIDIQATVSIGLAHSGDAGQSLAEL
LAAADEALYRAKSLGGNRLESAQNAARLRVVR