Protein Info for H281DRAFT_01270 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF01370: Epimerase" amino acids 3 to 59 (57 residues), 21.1 bits, see alignment E=2.8e-08 PF13460: NAD_binding_10" amino acids 7 to 173 (167 residues), 39.4 bits, see alignment E=9e-14 PF05368: NmrA" amino acids 43 to 204 (162 residues), 34.3 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_5489)

Predicted SEED Role

"Putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MKL8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>H281DRAFT_01270 Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains (Paraburkholderia bryophila 376MFSha3.1)
MKIVVIGGTGLIGSKTVTILRDAGHDVLAASPRSGINTLTGEGLQEALQGAQVVIDLANS
PSFEDSAVLEFFETSGRNLHAAEAAAGVGHHVALSIVGTDRTPENGYFRAKVAQEKLIEA
SGIPYTIIRSTQFLEFLGGIAASSAEGNTVRLSPGLFQPIASDDVAAFVADVALAAPRNG
IVEIAGPQRAPFDEIVASYLKAIGDPREVVRDPEARYFGGRVEELSLVPLGEARLGRIGL
EEWLSRSKAAG