Protein Info for H281DRAFT_01268 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RNA polymerase sigma-70 factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR02957: RNA polymerase sigma-70 factor, TIGR02957 family" amino acids 7 to 286 (280 residues), 373.1 bits, see alignment E=7.9e-116 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 10 to 161 (152 residues), 61 bits, see alignment E=1.1e-20 PF04542: Sigma70_r2" amino acids 11 to 71 (61 residues), 53 bits, see alignment E=2.4e-18 PF08281: Sigma70_r4_2" amino acids 107 to 158 (52 residues), 47.1 bits, see alignment 1.5e-16

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 86% identity to bug:BC1001_3909)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>H281DRAFT_01268 RNA polymerase sigma-70 factor, ECF subfamily (Paraburkholderia bryophila 376MFSha3.1)
MDDDVSAFNGLRPRLQKIAYRMLGSVAEAEDIVQDVWLRWHAAAREKIDNAEAWLVAVTT
RVSIDRLRAAKTQREHYTGIWLPEPQMTGSPATPEEAVERSDDVSVAFLMLLERLTPEAR
AAFLLREVFDADYDEVARAIGKSEAACRQLVSRAKGQLREERPRNAVPQETHHRLLRMFA
QAVERGDFPAINALLAEDAMLIGDGGGKVPSAPQPMLGGRRIAQLFYASSRRYGSELSMR
LVVLNGEWALLRFFEGKLESAQAVETDNERIVRILVQRNPEKLARLAAACPNG