Protein Info for H281DRAFT_01224 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted metal-dependent hydrolase, TIM-barrel fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04909: Amidohydro_2
  • amino acids 4 to 297 (294 residues), 131 bits, E=3.8e-42

Best Hits

Swiss-Prot: 47% identical to Y4MH_SINFN: Uncharacterized protein y4mH (NGR_a02510) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07046, (no description) (inferred from 90% identity to bxe:Bxe_B1034)

Predicted SEED Role

"L-fuconolactone hydrolase" in subsystem L-fucose utilization temp

Protein Sequence (297 amino acids)

>H281DRAFT_01224 Predicted metal-dependent hydrolase, TIM-barrel fold (Paraburkholderia bryophila 376MFSha3.1)
MQVVDSHIHLWDLKTHRYPWLENPGVSFVGDARDLKHDYLLADLLGEAGDIDVKKVVHVE
ANHDPADPVEETRWLQGIADRHESRGMPNAIVAAVDLSSADAPALLEAHASFANTRGIRQ
ILNVHENRLFDYVGRHFMREPQWRENFALLRRYDMSFDLQLYPSQMEEAAALARAHGDTH
FAVNHAGMFVDRDSVAGYRAWRDGMGMLADCENVCVKISGLAMFDHHWTVESLRPYVLET
IDTFGVERAMFASNFPVDRLFGSYAGLWHAYATIVEGASAAEKEALFCGNAERFYRI