Protein Info for H281DRAFT_01207 in Paraburkholderia bryophila 376MFSha3.1

Annotation: SPFH domain, Band 7 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 24 (5 residues), see Phobius details PF01145: Band_7" amino acids 28 to 195 (168 residues), 129.7 bits, see alignment E=6.5e-42

Best Hits

Swiss-Prot: 55% identical to Y1420_ARCFU: Uncharacterized protein AF_1420 (AF_1420) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: None (inferred from 97% identity to bug:BC1001_3838)

Predicted SEED Role

"Putative stomatin/prohibitin-family membrane protease subunit aq_911" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMN1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>H281DRAFT_01207 SPFH domain, Band 7 family protein (Paraburkholderia bryophila 376MFSha3.1)
MIGFTFGFSSILILMAAALIASSIRIFREYERGVVFMLGRFWKVKGPGLVLIIPVVQQAV
RMDLRTVVFDVPPQDVITRDNVSVKVNAVVYFRVVDPEKAVIQVARYFEATSQLSQTTLR
AVLGKHELDELLADREQLNADIQKVLDAQTDAWGIKVAIVEIKHVDINETMIRAIARQAE
AERERRAKVIHAEGELQASQQLLQAAQTLAREPQAMQLRYLQTLTTIAADKNSTIVFPLP
VDLLNAVVERLTRPPPP