Protein Info for H281DRAFT_01201 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF03446: NAD_binding_2" amino acids 2 to 161 (160 residues), 190.9 bits, see alignment E=3.2e-60 PF03807: F420_oxidored" amino acids 2 to 69 (68 residues), 31.4 bits, see alignment E=4.9e-11 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 5 to 292 (288 residues), 462.9 bits, see alignment E=2.2e-143 PF14833: NAD_binding_11" amino acids 164 to 291 (128 residues), 116.1 bits, see alignment E=2.3e-37

Best Hits

Swiss-Prot: 54% identical to 3HIDH_DICDI: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial (hibA) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 93% identity to bgf:BC1003_5576)

MetaCyc: 68% identical to 3-hydroxyisobutyrate dehydrogenase subunit (Pseudomonas putida)
3-hydroxyisobutyrate dehydrogenase. [EC: 1.1.1.31]

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIS0 at UniProt or InterPro

Protein Sequence (309 amino acids)

>H281DRAFT_01201 3-hydroxyisobutyrate dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MKIGFIGLGNMGAPMAHNLLKAGHAVNVFDLNAQAVQALVDAGAHAAASPKAAVADVECV
ITMLPAAAHVRSVLTADDGVLAGIPQGVTIVDSSTIDPASVKAFAELAQQRGNTFVDAPV
SGGTGGAAAGTLTFMVGGSASAYEKVKPVLSAMGRNIVHCGDTGTGQVAKICNNLVLGIT
MAGVAEAMSLGEALGIDVKVLAGIINTSTGRCWSSDTYNPMPGVIDSAPSSREYSGGFGT
DLMLKDLGLATDAARFARQPVYLGALAQQLYQTMSAKGAGRLDFSAVIKLYRHETAENTA
KATGNGDAR