Protein Info for H281DRAFT_01200 in Paraburkholderia bryophila 376MFSha3.1

Annotation: short chain enoyl-CoA hydratase (EC 4.2.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 9 to 256 (248 residues), 197.4 bits, E=2.6e-62
• PF16113: ECH_2
  • amino acids 14 to 187 (174 residues), 94.5 bits, E=9.3e-31

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 88% identity to bgf:BC1003_5577)

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• adipate biosynthesis (4/5 steps found)
• benzoyl-CoA degradation I (aerobic) (5/7 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• valproate β-oxidation (6/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• L-valine degradation I (5/8 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

See A0A2Z5MIY6 at UniProt or InterPro

Protein Sequence (278 amino acids)

>H281DRAFT_01200 short chain enoyl-CoA hydratase (EC 4.2.1.17) (Paraburkholderia bryophila 376MFSha3.1)
MIELDYAHEGAVAQLTLKRPPANAFTPDGLLQLQQTVERLNGETRVRAIVITGEGPKFFS
AGADLNAFADGNREVARVAAARFGAAFEALQNARPVVIAAINGFAMGGGLECALACDIRI
AEQHAVMALPETAVGLLPCGCGTQTLPWLVGEGWAKRMILTGERVDAATALRIGLVEEVV
EKGAAREAALSMAARVATLSPQAVGFSKTLIHQGRNGVPRSAALALERERFVDLFDGADQ
REGVNAFLEKRTPRWQIAQGEHTASSTQAAHARGETQR