Protein Info for H281DRAFT_01200 in Paraburkholderia bryophila 376MFSha3.1

Annotation: short chain enoyl-CoA hydratase (EC 4.2.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00378: ECH_1" amino acids 9 to 256 (248 residues), 197.4 bits, see alignment E=2.6e-62 PF16113: ECH_2" amino acids 14 to 187 (174 residues), 94.5 bits, see alignment E=9.3e-31

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 88% identity to bgf:BC1003_5577)

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MIY6 at UniProt or InterPro

Protein Sequence (278 amino acids)

>H281DRAFT_01200 short chain enoyl-CoA hydratase (EC 4.2.1.17) (Paraburkholderia bryophila 376MFSha3.1)
MIELDYAHEGAVAQLTLKRPPANAFTPDGLLQLQQTVERLNGETRVRAIVITGEGPKFFS
AGADLNAFADGNREVARVAAARFGAAFEALQNARPVVIAAINGFAMGGGLECALACDIRI
AEQHAVMALPETAVGLLPCGCGTQTLPWLVGEGWAKRMILTGERVDAATALRIGLVEEVV
EKGAAREAALSMAARVATLSPQAVGFSKTLIHQGRNGVPRSAALALERERFVDLFDGADQ
REGVNAFLEKRTPRWQIAQGEHTASSTQAAHARGETQR