Protein Info for H281DRAFT_01192 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Glycine/D-amino acid oxidase (deaminating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12831: FAD_oxidored
  • amino acids 15 to 188 (174 residues), 36.6 bits, E=8.6e-13
• PF01266: DAO
  • amino acids 15 to 364 (350 residues), 225.8 bits, E=2.9e-70
• PF00890: FAD_binding_2
  • amino acids 15 to 67 (53 residues), 30.6 bits, 5.4e-11
• PF13450: NAD_binding_8
  • amino acids 18 to 50 (33 residues), 29 bits, 2.7e-10

Best Hits

KEGG orthology group: None (inferred from 63% identity to bge:BC1002_4387)

Predicted SEED Role

"D-amino-acid oxidase (EC 1.4.3.3)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 1.4.3.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• butanol and isobutanol biosynthesis (engineered) (4/8 steps found)
• L-lysine degradation V (2/9 steps found)
• superpathway of L-lysine degradation (11/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Arginine and D-ornithine metabolism
• Glycine, serine and threonine metabolism
• Penicillin and cephalosporin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.3

Protein Sequence (393 amino acids)

>H281DRAFT_01192 Glycine/D-amino acid oxidase (deaminating) (Paraburkholderia bryophila 376MFSha3.1)
MGHSRVIQPGQSSPDVVVVGAGIVGAACAHELAKQGADVLVLDRAGVGGGVTAAGMGHLV
LMDDSPAEFALSAWSRELWLELAPRLSAREAFVRCGTLWVAVDDEEYELAQTRQQALVQA
GVDCSLLDAQQMREAEPELREGLRGGMMLPDDAVVYAPAAAAWLLAQPVKGRVTCRLDTQ
VVRVNREGVVLESGEAIAAGAVLVANGLQASDLLPGLPMQAKKGHLLITDRYPGTIRHQI
LELGYIKSAHNASGTSVAFNVQPRPTGQILIGSSRQFDTVDPAIEPDVLARMLRRAAEYL
PTLPTLNAIRAWTGFRPATSDGLPLIGPAAPFGDDSCHRSTWLATGHEGLGVTTALATAK
LIAAQMLDLGDVLPIDAAPYLPARFENVGASHA