Protein Info for H281DRAFT_01160 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, IclR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF09339: HTH_IclR" amino acids 34 to 83 (50 residues), 50.7 bits, see alignment 3.1e-17 PF12802: MarR_2" amino acids 39 to 84 (46 residues), 37.7 bits, see alignment 4.7e-13 PF13412: HTH_24" amino acids 39 to 81 (43 residues), 28.5 bits, see alignment 2.3e-10 PF08279: HTH_11" amino acids 42 to 79 (38 residues), 27.7 bits, see alignment 5.2e-10 PF01614: IclR" amino acids 149 to 273 (125 residues), 131.2 bits, see alignment E=5.5e-42

Best Hits

Swiss-Prot: 62% identical to KDGR_DICCH: Pectin degradation repressor protein KdgR (kdgR) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 92% identity to bgf:BC1003_1821)

Predicted SEED Role

"Transcriptional regulator KdgR, KDG operon repressor" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFJ7 at UniProt or InterPro

Protein Sequence (291 amino acids)

>H281DRAFT_01160 transcriptional regulator, IclR family (Paraburkholderia bryophila 376MFSha3.1)
MAATGKQRKGDPAALAHDVESVECGNDKGESASSIGRVFALLAAIGDSGQIGISELSQRL
GMSKTTVHRVVQTLKALGYVTQEVETERYRLTIRLFELGAKALESVDLVREADVEMRRIG
AVTREAVHLGAFDEDAIIYIHKIDADYGLRMQSRIGRRNPLHSTAIGKVLLAWMDPADAR
EVLSHVEFRKSTQKTLSSAEAVLSILPRVREQGYGEDNEEQEEGLQCLAVPVFDRFGRVI
AGLSVSFPTMRCGADTKSHYVALLKQSGEAISARLGYREEAAPEHAAVQPG