Protein Info for H281DRAFT_01159 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 2-deoxy-D-gluconate 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR01832: 2-deoxy-D-gluconate 3-dehydrogenase" amino acids 19 to 266 (248 residues), 411.3 bits, see alignment E=7.2e-128 PF00106: adh_short" amino acids 24 to 215 (192 residues), 184 bits, see alignment E=3.4e-58 PF08659: KR" amino acids 27 to 177 (151 residues), 37.9 bits, see alignment E=2.7e-13 PF13561: adh_short_C2" amino acids 32 to 263 (232 residues), 198.6 bits, see alignment E=1.8e-62

Best Hits

Swiss-Prot: 68% identical to KDUD_ECOLI: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to bug:BC1001_1555)

MetaCyc: 68% identical to putative 2-keto-3-deoxy-D-gluconate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]; 1.1.1.- [EC: 1.1.1.127]; RXN0-7101 [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>H281DRAFT_01159 2-deoxy-D-gluconate 3-dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MGSDIVTIPAINRSAANPFDLGGKVAIVTGSNTGLGAGMALALAQAGCDIVGVSRADAGD
TPARVEVTGRRFADVRADLSSTAPVEDIVRAAVEAFGRIDVLVNNAGIIRRQDALDFTED
DWDAVMDLNLKSLFFLAQAAARQFVKQQSGGKIINIASMLSFQGGIRVASYTASKSGVLG
LTRLLANEWAAKRINVNAIAPGYMATANTAALREDAQRNDEILSRIPAGRWGAPDDLAGP
VVFLASSASDYVHGHTLAVDGGWLAR