Protein Info for H281DRAFT_01131 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 194 (188 residues), 182.9 bits, E=9.9e-58
• PF08659: KR
  • amino acids 10 to 167 (158 residues), 61.1 bits, E=2.8e-20
• PF13561: adh_short_C2
  • amino acids 13 to 246 (234 residues), 214.8 bits, E=2.7e-67
• PF08643: DUF1776
  • amino acids 92 to 205 (114 residues), 29.5 bits, E=1e-10

Best Hits

Swiss-Prot: 72% identical to Y182_METEA: Uncharacterized oxidoreductase MexAM1_META1p0182 (MexAM1_META1p0182) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 92% identity to bgf:BC1003_1812)

MetaCyc: 40% identical to 3-oxoacyl-[acyl-carrier-protein] reductase (Bacillus subtilis subtilis 168)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
• oleate biosynthesis IV (anaerobic) (14/14 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• D-sorbitol degradation II (1/1 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• L-sorbose degradation (1/2 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Fructose and mannose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.140

Sequence Analysis Tools

See A0A2Z5MBB0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>H281DRAFT_01131 3-oxoacyl-[acyl-carrier protein] reductase (Paraburkholderia bryophila 376MFSha3.1)
MSKLAGKVAVVTGASKGIGAAIAKSLAAHGASVVVNYASSKAGADDVVAAITAAGGKAVA
VAGDVSKAADAKGIVDAAVEKYGRLDILVNNSGVYGFSTIEEITEEHFHKHFNVNVLGLL
LVTQAAVKHLGEGGSIVNVSSVVSRITPPGSAVYTATKGAVDGITGVLAKELGPRKIRVN
SVNPGMVATEGTHSAGFIGSDLETWAVSTTPLGRIGQPDDIAEVVAFLASDEARWLTGES
LIASGGSR