Protein Info for H281DRAFT_01116 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): deoxyribose kinase (EC 2.7.1.15)
Rationale: Important for utilization of deoxyribose and deoxynucleosides. Deoxynucleosides might be hydrolyzed to deoxyribose.
Original annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00294: PfkB" amino acids 10 to 302 (293 residues), 196.7 bits, see alignment E=5.8e-62 TIGR02152: ribokinase" amino acids 11 to 307 (297 residues), 304.7 bits, see alignment E=3.6e-95 PF08543: Phos_pyr_kin" amino acids 177 to 281 (105 residues), 43.7 bits, see alignment E=2.4e-15

Best Hits

Swiss-Prot: 40% identical to RBSK_ECOLI: Ribokinase (rbsK) from Escherichia coli (strain K12)

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 92% identity to bgf:BC1003_1805)

MetaCyc: 40% identical to ribokinase (Escherichia coli K-12 substr. MG1655)
Ribokinase. [EC: 2.7.1.15]

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.15

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MB93 at UniProt or InterPro

Protein Sequence (320 amino acids)

>H281DRAFT_01116 deoxyribose kinase (EC 2.7.1.15) (Paraburkholderia bryophila 376MFSha3.1)
MSSQPQQSGRVVILGIYVTDLTFRAARMPLVGETIAGSAFAMGPGGKGSNQAVAAARAGA
EVVFCTRIGNDAFGSIAQATWAREGITARASVVEGVSTGAAHIFVDDTTGMNAIIVAAGA
AGTLSAADVDAIEADIAGSRVFVTQLEQPLAAARRGLEVARKHGVTTVFNPAPALPLDDD
IFPLCDYITPNETEAAALTGVPIANVDDARRAADVLLAKGVGTVIVTLGEGGALLHDATQ
SIWLPAFRCGAVVETAGAGDGFTGGFAAALARGEDAISAMRFGCALAGISVTRAGTAPSM
PTLAEVNRVLSESAQPAQAS