Protein Info for H281DRAFT_01115 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): deoxynucleoside transporter, permease component 1
Rationale: Important for utilization of dAMP and deoxyinosine. Because the fitness profiles for these compounds are very similar, dAMP is likely hydrolyzed before uptake, but this could also be a transporter for deoxynucleotides.
Original annotation: monosaccharide ABC transporter membrane protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 317 (265 residues), 105.4 bits, see alignment E=1.5e-34

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 92% identity to bxe:Bxe_B1402)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MCP0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>H281DRAFT_01115 deoxynucleoside transporter, permease component 1 (Paraburkholderia bryophila 376MFSha3.1)
MKSSFAAGKLFADRQLNFLLIVNVLVVLVATWLSRGQFVDIDNLQSMGGQLPELGLLALG
IMLSMVSGNGGIDLSGVGLANLSGMVAAMLVPRLVNGDDSPVLYTSLFCAIVLMMGLLGG
LLNGVVIARLRLTPILCTLGTQLLFTGFAVVISNGASVHVDYVEPLSDIGNGTVLQVPIA
FCIFLAAVIVLGWLLKRSPFGLRLYLMGTNPKAAFYAGIPRARMLITTYAMCGVLASLAG
LISATHTSSAKWDYGNSYLLIAILIAVMGGVNPAGGHGRIICVFFAATVLQFLSSLFNLL
GVSQFFGDCAWGFLLLLSLAFAGGERVRAIFGLGGGGGSTQPAKPPASGSAGATQRR