Protein Info for H281DRAFT_01114 in Paraburkholderia bryophila 376MFSha3.1

Updated annotation (from data): deoxynucleoside transporter, substrate-binding component
Rationale: Important for utilization of dAMP and deoxyinosine. Because the fitness profiles for these compounds are very similar, dAMP is likely hydrolyzed before uptake, but this could also be a transporter for deoxynucleotides.
Original annotation: monosaccharide ABC transporter substrate-binding protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00532: Peripla_BP_1
  • amino acids 30 to 241 (212 residues), 29.3 bits, E=6.2e-11
• PF13407: Peripla_BP_4
  • amino acids 31 to 288 (258 residues), 212.1 bits, E=1.1e-66

Best Hits

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 97% identity to bpy:Bphyt_5192)

Predicted SEED Role

"ABC transporter, periplasmic sugar-binding protein precursor"

Sequence Analysis Tools

See A0A2Z5MD45 at UniProt or InterPro

Protein Sequence (334 amino acids)

>H281DRAFT_01114 deoxynucleoside transporter, substrate-binding component (Paraburkholderia bryophila 376MFSha3.1)
MKLTRLGAALAAAALTVGVIAAAQAATNETIVTVVKVTGINWFNRMDEGVKEFAKDNPGV
TAYQTGPGRADAAQQLKIIEDLIAKKVNAIAVVPYDPPTLEPALKKAMDRGIKVVTHEAD
NAKNTMVDIEAFDNTAYGAGLNERLASCMHNEGKWAVLVGSLGSRSQVQWADGGIGNAKA
KYAKMNLVEPKLETNNDGERAYEVAKEVLRKHPDLKGFQGSSSLDVIGIGRAVEEAGMQG
KICVYGTGLPTEAGKFLESGAINGIAFWDPKLAGIAMNKVAKMLVDGKTVENGADLGIPG
YTKVTVAKGPGKGIIVRGQGWVNVDKSNYKQYPF