Protein Info for H281DRAFT_01103 in Paraburkholderia bryophila 376MFSha3.1

Annotation: starvation-inducible DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 29 to 45 (17 residues), see Phobius details PF00210: Ferritin" amino acids 31 to 165 (135 residues), 82.5 bits, see alignment E=1.5e-27

Best Hits

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 92% identity to bgf:BC1003_1791)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHE3 at UniProt or InterPro

Protein Sequence (172 amino acids)

>H281DRAFT_01103 starvation-inducible DNA-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MKDLKQAAAHRAASLRTPTRLTEDATRDIAAALTTLLADVFALYLKTKNFHWHMSGPYFR
DYHLLLDDQANQIYATTDPIAERARKIGGKTLRSAGHITKLQRIADNDADFVTPGDMLAE
LREDNLALAGYMRETHSLCDEYGDVATASLLENWIDEAEQRVWFLFESGRHD