Protein Info for H281DRAFT_01077 in Paraburkholderia bryophila 376MFSha3.1

Annotation: benzoate/toluate 1,2-dioxygenase reductase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 10 to 86 (77 residues), 59 bits, E=7.1e-20
• PF00970: FAD_binding_6
  • amino acids 114 to 201 (88 residues), 48 bits, E=2.8e-16
• PF00175: NAD_binding_1
  • amino acids 211 to 313 (103 residues), 75.9 bits, E=7.8e-25

Best Hits

Swiss-Prot: 54% identical to XYLZ_PSEPU: Toluate 1,2-dioxygenase electron transfer component (xylZ) from Pseudomonas putida

KEGG orthology group: K05784, benzoate 1,2-dioxygenase electron transfer component (inferred from 89% identity to bpy:Bphyt_1593)

MetaCyc: 54% identical to XylZ (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"2-chlorobenzoate 1,2-dioxygenase reductase component"

MetaCyc Pathways

• meta cleavage pathway of aromatic compounds (9/10 steps found)
• benzoate degradation I (aerobic) (2/2 steps found)
• mandelate degradation to acetyl-CoA (13/18 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (22/35 steps found)
• superpathway of aerobic toluene degradation (16/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (18/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Protein Sequence (340 amino acids)

>H281DRAFT_01077 benzoate/toluate 1,2-dioxygenase reductase subunit (Paraburkholderia bryophila 376MFSha3.1)
MSSYNIALNFEDGVTRFVECKAGEKVLDAAFRARINLPMDCSDGVCGTCKCRAESGRYDL
GDDYIEDALTDDEKQSGLVLTCQMVPESDCVIAVPASSTACKTEQSKFAATVTKVEKHND
AAVVLEMDVDGTPPVFLAGQYVNIDVPGSGQHRSYSFSSLPGESKICFLIKKISGGVMST
WLESAQPGNKVQLTGPMGTFYLRAVERPLLFLAGGTGLAPFLSMLEVLARANSQQKVHLI
YGVTRDLDLVLVEDIQAYTLRLPNFTFSTVVAATESVHPRKGWVTQHMPAECINDGDVDV
YLCGPPPMVDAVRQYFDENGVEPASFHYEKFTPNAALVDA