Protein Info for H281DRAFT_01056 in Paraburkholderia bryophila 376MFSha3.1

Annotation: monosaccharide ABC transporter membrane protein, CUT2 family (TC 3.A.1.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 303 to 320 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 315 (264 residues), 131.1 bits, see alignment E=2.2e-42

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 38% identity to cpo:COPRO5265_1466)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>H281DRAFT_01056 monosaccharide ABC transporter membrane protein, CUT2 family (TC 3.A.1.2.-) (Paraburkholderia bryophila 376MFSha3.1)
MSTLIDRTGGRATGMRRHVAHNAAPLAGFCLLVLLLIAGAYASDRFATVGNLLNVHQQAT
GLALVALGQTLAILTGGIDLSVGSLISASATLTSGLADNPHGGWTSAIVVVLLLSAVVGL
INGGLVLRLKVHPLIVTLGMGAVLQGAILYYSLGPAGNVPDGFDSIAYGRFLNIPVTATI
VVLLYFALSFFMRRTRLGHYIYMVGDDEHAASLTGVPKARVILFVYVFSAICAGVTGIYL
AAQFGSGQPYLGVNYTLASITPVVVGGTVLTGGRGGVIGTLIAVYLLSLLNNLINFAGIA
SQYQLIVQGLAVIIAVSVNAQRKRVTA