Protein Info for H281DRAFT_01028 in Paraburkholderia bryophila 376MFSha3.1

Annotation: peptide/nickel transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 157 to 173 (17 residues), see Phobius details amino acids 210 to 237 (28 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details PF12911: OppC_N" amino acids 24 to 70 (47 residues), 48.4 bits, see alignment 6.8e-17 PF00528: BPD_transp_1" amino acids 111 to 292 (182 residues), 121.5 bits, see alignment E=3.6e-39

Best Hits

Swiss-Prot: 47% identical to GSID_SHIF8: Glutathione transport system permease protein GsiD (gsiD) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 94% identity to bph:Bphy_6649)

MetaCyc: 46% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>H281DRAFT_01028 peptide/nickel transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MATSIDARSASAAAALPRRQRRGLTRFMRNRAAVFGAFLVTLIVIMALFAPWLTHYDPVQ
ASFMTVRQAPSAAHWFGTDELGRDVLSRLLYGARASLLAGVVSVGIAVVLGVPLGLIAGY
FGRFVDGVISRIADALLSIPFLILAIALSAFLGPSLTNAMAAIGISAMPRFIRLTRGQAI
SVKAEEYVEGARAIGLDHARIMLRYILPNVLPPIIVQASLTVASAIIAEASLSFLGLGQL
PPAPSWGSMLNTAKDFVSQAPWMSIFPGIAIFLAVLGFNLLGDGLRDALDPRES