Protein Info for H281DRAFT_01012 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Ribosomal protein S18 acetylase RimI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00583: Acetyltransf_1" amino acids 21 to 136 (116 residues), 51.3 bits, see alignment E=2.1e-17 PF13673: Acetyltransf_10" amino acids 39 to 136 (98 residues), 32.4 bits, see alignment E=1.2e-11 PF13508: Acetyltransf_7" amino acids 75 to 136 (62 residues), 41.2 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 38% identical to HPA3_YEAST: D-amino-acid N-acetyltransferase HPA3 (HPA3) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_5710)

Predicted SEED Role

"acetyltransferase (GNAT) family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>H281DRAFT_01012 Ribosomal protein S18 acetylase RimI (Paraburkholderia bryophila 376MFSha3.1)
MLSVQIKAIEKNDFDIWLPLWKDYQRFYEVDIPESVTLETWARFVDPMEPMHAALAMMGE
HAFGLVHSIYHRSTWTTASYCYLQDLFVATDARGGGIGRALIEHVYADAKRRGAARVHWL
THQTNAAAMRLYESVGDRSGFVQYRKLFT