Protein Info for H281DRAFT_00960 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 81 to 107 (27 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 297 to 312 (16 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 41 to 381 (341 residues), 128.7 bits, see alignment E=1.3e-41

Best Hits

KEGG orthology group: None (inferred from 87% identity to bxe:Bxe_A2227)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>H281DRAFT_00960 Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains (Paraburkholderia bryophila 376MFSha3.1)
MSDPALDAAGSSLPLSPPVTAAAPRVQSDARADSAGKEHVIDAMRGFAALLVAYFHCRQI
EWVGMQAFHQNAGHSLSLKTIAAYLTFPIAWGSAGVPIFFVISGYCIHRSGALRLANNPA
YRLDAGNFWVRRFTRIYPVLLAALLLTLALDWFSLQLPPVSHKIREIGVQAFLVNLFSLQ
GVAGKTYGSNGALWTLSLEVQFYAIYPLLFALRRRIGMTSVLAIVGVVNLVSAYVLERHD
IQFFTSYWFSWTLGAWIADAKARTSAKTGSPRWLYALAAGFIALGCAAFHYGQYGAFQLW
AIGFAFYLYKALERGNANQRDGWGLRLLSRFGDFSFSLYLIHLPIFVLLSSVLYRSSLQM
SIWPSFGYMLVALPAAYVFYRLVELPAMNWSASFKPKSAKGAFVKS