Protein Info for H281DRAFT_00956 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 303 (24 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 321 (305 residues), 105.3 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to bgf:BC1003_1681)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MG29 at UniProt or InterPro

Protein Sequence (365 amino acids)

>H281DRAFT_00956 Peptidoglycan/LPS O-acetylase OafA/YrhL, contains acyltransferase and SGNH-hydrolase domains (Paraburkholderia bryophila 376MFSha3.1)
MTVSAMPSAPSHSRRIVQLDGLRAIAVLAVFAQHALKAPLWMGVDLFFVLSGFLITGILL
ERKAREQSYFGYFYARRARRILPPYLLLMAVSSILFGFGWAQHWQWYAFFATNIGDALNQ
SGHDSLNVLWSLAVEEQFYIVWPFVILFVPERALAWVAAALVLLVPVLRAVATPWFDSFW
PIYYLTPFRMDLLAAGALLAVAVRRDRHALEPFKGVAVLGVIAALAALAWLHLHFPRFRA
ANTPLSNAGLYSISLVLCTSVVVIALQSKGIVKRLLCNPVLVYIGTISYTIYLIHLSVLY
ALWPLQMNRYVSAALALVITIAYASLTWFGFEKRLIFGSRGNVHATAGTSAGVASAAPQV
PQSRA