Protein Info for H281DRAFT_00954 in Paraburkholderia bryophila 376MFSha3.1

Annotation: GDPmannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 6 to 338 (333 residues), 452 bits, see alignment E=6.9e-140 PF01370: Epimerase" amino acids 8 to 248 (241 residues), 215.1 bits, see alignment E=1e-67 PF16363: GDP_Man_Dehyd" amino acids 8 to 333 (326 residues), 444.8 bits, see alignment E=2.4e-137

Best Hits

Swiss-Prot: 70% identical to GM4D_AGGAC: GDP-mannose 4,6-dehydratase (gmd) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 95% identity to bug:BC1001_1649)

MetaCyc: 70% identical to GDP-alpha-D-mannose 4,6-dehydratase (Aggregatibacter actinomycetemcomitans)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.47

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MB07 at UniProt or InterPro

Protein Sequence (347 amino acids)

>H281DRAFT_00954 GDPmannose 4,6-dehydratase (Paraburkholderia bryophila 376MFSha3.1)
MSQPRKAIITGVSGQDGAYLTRLLLDKGYQVTGTYRRTSSVNFWRMRELGVLDHPNLRLV
EHDLTDLGSTLRLLEGAQADELYNLAAQSFVGVSFDQPVTTAEVTGIGALNLLEGIRILN
PKMRYYQASTSEMFGLVQAVPQREDTPFYPRSPYGVAKLFAHWSTINYRESYGLFASSGI
LFNHESPLRGREFVTRKITDTVAKIKLGKQDVLELGNLGAKRDWGFALEYVEGMWRMLQA
DEPDTFVLATGRTETVRDFARMAFAAADYQIEWSGKEERETGIDVATGKTLVRVNPKFYR
PAEVDLLIGCADKAREKLGWQAQTTLEQLCHMMVHADIGRNQQHETF