Protein Info for H281DRAFT_00948 in Paraburkholderia bryophila 376MFSha3.1

Annotation: tyrosine-protein kinase Etk/Wzc

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 440 to 460 (21 residues), see Phobius details amino acids 541 to 565 (25 residues), see Phobius details PF02706: Wzz" amino acids 14 to 105 (92 residues), 51.9 bits, see alignment E=2.3e-17 PF13807: GNVR" amino acids 383 to 462 (80 residues), 96.4 bits, see alignment E=2.2e-31 TIGR01007: capsular exopolysaccharide family" amino acids 521 to 714 (194 residues), 151.1 bits, see alignment E=1.4e-48 PF13614: AAA_31" amino acids 541 to 665 (125 residues), 49.1 bits, see alignment E=2e-16 PF09140: MipZ" amino acids 541 to 657 (117 residues), 23.8 bits, see alignment E=7.7e-09 PF10609: ParA" amino acids 542 to 658 (117 residues), 27.3 bits, see alignment E=7.2e-10 PF01656: CbiA" amino acids 543 to 584 (42 residues), 33.3 bits, see alignment 1.3e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_1673)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.10.2

Use Curated BLAST to search for 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAE2 at UniProt or InterPro

Protein Sequence (732 amino acids)

>H281DRAFT_00948 tyrosine-protein kinase Etk/Wzc (Paraburkholderia bryophila 376MFSha3.1)
MTGPLRTEEEDVVLGQLVQVILDDIWWLIAIAAAVVAIAGAYCVLAKPIYSADAHVRVEQ
ADNTSQALTQTQTGAAITSGSTSLPTDAEIEIIKSRGVVGPVVEQMKLNFSVTPKTLPLL
GSIAARMATPGQPARPWLGLSSYAWGGEVADIDSIDVLPALEGQKLTMKALGGDRYELHA
ENGALLLRGQVGQQAQGGGVTMLVNKLVARPGEEFTVVRANDLDAISAFQSAISVQEQGK
QTGVIQISLEDKNPEHAALVANALAQSYVRQHVSNKQADASKMLDFLKSEEPRLKSDLER
AEAALTAYQRQSGSINASEEAKVYLEGSVQYEQQIAGLRLQMAQLIERYGDDHPMLKAAR
EQMAELQAQRAKYADRFRDLPATEVKAVQLQRDAKVAEDIYVLLLNRVQELSVQKAGTGG
NVHIVDAALRPGAPVKPKKALILSAATILGLIAGTGFVFLRRNMFKGIDDPEHIERAFHL
PVFGLVPMSAEQTLLENGFQRGGERLRSVLANARPKDVTVESLRSLRTSMQFTMMDAKNR
IVMLTGPMAGVGKSFLTVNLAVLLAHSGKRVLMIDGDMRRGVLERFLGGTQDNGLSELLS
GQISLEEAIRASEIENLSFISCGRRPPNPSELLMSPRLPQYLDGLAKRYDVILVDTPPVL
AVTDASIIGAYAGSTFFVMRSGMHSEGEITDALKRLRAAGVHVQGGIFNGMPARARGGYD
RSYAAVQEYLST