Protein Info for H281DRAFT_00912 in Paraburkholderia bryophila 376MFSha3.1

Annotation: intracellular septation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 15 to 42 (28 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 1 to 176 (176 residues), 185.3 bits, see alignment E=5.7e-59 PF04279: IspA" amino acids 1 to 175 (175 residues), 230.3 bits, see alignment E=9.2e-73

Best Hits

Swiss-Prot: 97% identical to YCIB_PARPJ: Probable intracellular septation protein A (Bphyt_1922) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K06190, intracellular septation protein (inferred from 96% identity to bxe:Bxe_A2278)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAB6 at UniProt or InterPro

Protein Sequence (176 amino acids)

>H281DRAFT_00912 intracellular septation protein (Paraburkholderia bryophila 376MFSha3.1)
MKFLFDLFPIILFFVAFKVWGIFTATAVAIVATLVQIAWVAFRHRKVDPMLWVSLGVVTV
FGGATLVLHNDTFIKWKPTVLYWAFSVVLIVSQLAFNKNLIEAMMGKQITLPHAIWSKLS
VIWAIFFVLLGLLNLFVAYNYTTDQWVNFKLFGATGCLVVFIVGQSLWLSKYMKEE