Protein Info for H281DRAFT_00905 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative ABC transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00005: ABC_tran" amino acids 58 to 207 (150 residues), 117.1 bits, see alignment E=9.8e-38

Best Hits

Swiss-Prot: 54% identical to YBBA_ECO57: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli O157:H7

KEGG orthology group: K02003, (no description) (inferred from 98% identity to bgf:BC1003_1627)

MetaCyc: 42% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"putative ATP-binding component of a transport system"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MHC5 at UniProt or InterPro

Protein Sequence (258 amino acids)

>H281DRAFT_00905 putative ABC transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MTEPLATELVADVSAFARSFMARTFNLRFTMLNKTDPVIEVRGLCKKVKDATGELTILDN
IDLAIEAGSSVAIVGASGSGKSTLLGLLAGLDSASSGSVRLLGRELTTLNEDERAALRSG
SVGFVFQSFQLMPHLTALENVTLPLELQGGIGTREAALRARGLLEQVGLGQRTSHYPKLL
SGGEQQRVALARAFVTHPAILFADEPTGSLDAATGHAVIDLMFQMNRANGATLILVTHDV
ELARRCDTTVTIEAGRLA