Protein Info for H281DRAFT_00883 in Paraburkholderia bryophila 376MFSha3.1

Annotation: alkyl hydroperoxide reductase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF02627: CMD" amino acids 94 to 171 (78 residues), 47.9 bits, see alignment E=5.6e-17 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 111 to 160 (50 residues), 33.3 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 40% identical to AHPD_RHOP5: Alkyl hydroperoxide reductase AhpD (ahpD) from Rhodopseudomonas palustris (strain BisA53)

KEGG orthology group: K04756, alkyl hydroperoxide reductase subunit D (inferred from 96% identity to bug:BC1001_1717)

Predicted SEED Role

"Alkylhydroperoxidase protein D" in subsystem Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAU8 at UniProt or InterPro

Protein Sequence (172 amino acids)

>H281DRAFT_00883 alkyl hydroperoxide reductase subunit D (Paraburkholderia bryophila 376MFSha3.1)
MEFLSSIKALIPDYAKDIRLNLDGTIARSSLEGNDAVGVALAAAFAAKSNVIVNAIRNAG
VLSPEETNGALTAAALMGMNNVWYPYVEMAENADLKSQPAQLRMNAYASHGGVDKRRFEM
YALAASIIGKCHFCVKSHFDTLIAEGMSATQLRDVGRIAAVVNAAAQCIAAE