Protein Info for H281DRAFT_00879 in Paraburkholderia bryophila 376MFSha3.1

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 34 to 405 (372 residues), 369.9 bits, see alignment E=7e-115 PF01546: Peptidase_M20" amino acids 95 to 407 (313 residues), 124.2 bits, see alignment E=6.9e-40 PF07687: M20_dimer" amino acids 198 to 309 (112 residues), 78.5 bits, see alignment E=3.5e-26

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 94% identity to bgf:BC1003_1584)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MH04 at UniProt or InterPro

Protein Sequence (416 amino acids)

>H281DRAFT_00879 acetylornithine deacetylase (Paraburkholderia bryophila 376MFSha3.1)
MSHVADSAQSSQTSATASSDSASGTTPVSLPWVTRLVSMDTVSRNPNLGLIETVRDELRA
LGIEGTLTHDASGKWANLFATIPAHDGETNGGVVLSGHTDVVPVDGQQWDSDPFKPEIRG
DKLYGRGTCDMKGFIGAALALVPDMQRTKLAKPIHFALSFDEEVGCAGAPLLIADLMKRG
VKPDGCIVGEPTSMRPIVAHKGINAYQCCVRGQAAHSSLTPKGLNAIEYAARLICYIRDM
ADQFREQGPFDELYDVPFTTAQTSTIVGGNAINTVPAECKFQFEFRNLPTLDPEPIFARI
DQYARETLLPKMLREHPLAAIEITKIAAAPGLDSSEQAAITQLVRALTADQDKRKVAYGT
EAGLFSLAGIPSIVCGPGDIQQAHKANEFVALDQLVQCERFLHKFIHSMSVEAHAR