Protein Info for H281DRAFT_00878 in Paraburkholderia bryophila 376MFSha3.1
Annotation: threonine dehydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 68% identical to FSDH_RALPI: Phenylserine dehydratase (psdht) from Ralstonia pickettii
KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 96% identity to bgf:BC1003_1583)Predicted SEED Role
"Putative amino-acid dehydratase (EC 4.2.-.-)" (EC 4.2.-.-)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-threonine metabolism (15/18 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- L-threonine degradation I (5/6 steps found)
- L-methionine degradation II (2/3 steps found)
- L-threonine degradation V (1/2 steps found)
- hypoglycin biosynthesis (4/14 steps found)
- cyclosporin A biosynthesis (2/15 steps found)
KEGG Metabolic Maps
- Aminosugars metabolism
- Glycine, serine and threonine metabolism
- Nucleotide sugars metabolism
- Valine, leucine and isoleucine biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.2.-.-, 4.3.1.19
Use Curated BLAST to search for 4.2.-.- or 4.3.1.19
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MA84 at UniProt or InterPro
Protein Sequence (344 amino acids)
>H281DRAFT_00878 threonine dehydratase (Paraburkholderia bryophila 376MFSha3.1) MSTATPQHTDHTIDGEPIPTLDDIAAQHFALTPWVARTPVFDRLDFASLEGTVVNFKFEL LQAGGSFKARGAFTNLLALDETQRSAGVTCVSGGNHAVAVAYAAMRLGISAKVVLFRAAN PARVALCRQYRAEIVFAEDLAEAFELVRRIEAEEGRYFVHPFNGYRTVLGSATLGYEWST QTPDLEAVIVPIGGGGLAAGVATAMRLANPGVHVFGVEPEGADAMGKSFAANHTVKMGHM HGIADSLMAPHTEEYSYELCRRHIDELVTVSDDQLCAAMLTLFGQLKLAVEPACAAATAA LLGPLREKLQGKRVGVLLCGTNTDPVTFSAHIERARQGMSQFPT