Protein Info for H281DRAFT_00877 in Paraburkholderia bryophila 376MFSha3.1

Annotation: large conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details PF01741: MscL" amino acids 3 to 144 (142 residues), 149.5 bits, see alignment E=2.9e-48 TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 145 (143 residues), 125.4 bits, see alignment E=7.7e-41

Best Hits

Swiss-Prot: 93% identical to MSCL_PARXL: Large-conductance mechanosensitive channel (mscL) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 96% identity to bgf:BC1003_1582)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>H281DRAFT_00877 large conductance mechanosensitive channel (Paraburkholderia bryophila 376MFSha3.1)
MSMIKEFKEFALKGNVMDLAVGVIIGGAFSTIVNSVVKDLIMPVVGVATGGLDFSNKFIR
LGDIPASFKGSPESYKDLQTAGVAVFGYGSFITVAINFVILAFIIFLMVKFINNLRKPAD
AAPSEPPPPPEDVLLLREIRDSLKNSPR