Protein Info for H281DRAFT_00876 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PAS/PAC sensor hybrid histidine kinase (EC 2.7.13.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 PF00072: Response_reg" amino acids 13 to 114 (102 residues), 70.1 bits, see alignment E=5.2e-23 amino acids 537 to 646 (110 residues), 70.8 bits, see alignment E=3.3e-23 TIGR00229: PAS domain S-box protein" amino acids 144 to 269 (126 residues), 49.7 bits, see alignment E=2e-17 PF00989: PAS" amino acids 148 to 260 (113 residues), 33.3 bits, see alignment E=1.3e-11 PF08448: PAS_4" amino acids 155 to 264 (110 residues), 31.9 bits, see alignment E=4.1e-11 PF08447: PAS_3" amino acids 172 to 255 (84 residues), 65.7 bits, see alignment E=1.1e-21 PF00512: HisKA" amino acids 290 to 355 (66 residues), 52.1 bits, see alignment E=1.7e-17 PF02518: HATPase_c" amino acids 403 to 513 (111 residues), 96.2 bits, see alignment E=4.9e-31

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_1724)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MB24 at UniProt or InterPro

Protein Sequence (657 amino acids)

>H281DRAFT_00876 PAS/PAC sensor hybrid histidine kinase (EC 2.7.13.3) (Paraburkholderia bryophila 376MFSha3.1)
MTEEVSPPPAACILVVDDDEGILRLARKSLERAGCRVAVCASVEAARERLADGGLDLLVL
DYQLSGPQTGLDFFRRLRSEGVRIPAILVTGFTDESRVIEALRAGVSDVVPKSGDYLDYL
PEAVERVLSQVRLQRASEEALLLRDREQHYRNLSETLPHLVLTCNASGDCDFLSKQWYDY
TGLGENSSHGLAWLDAVHPDDREEVRRSWLKAVASNAGTYRHELRIRRHDGEYRWFDARM
VATRNAEGNFSKWFGSCTDVHSEREAMQERERLLASEQAARQTAEEANRAKDRFLAMLSH
ELRTPLTPVLAGASVLEMIPDLPDQARSSVRMIRRNVELEARLIDDLLDLTRVANGKLRL
SLETVDVHEVIDSVLELFRSEIQVKQQDVHVHKDAQHHYVLADRARLQQMLWNLIRNAAK
FTPDGGHIYVRTRDERMHVQICVEDTGIGIEPEQIGKLFNAFEQGDQNMTRQFGGLGLGL
AITKALTDVHGGTVTAQSPGPHCGATFTITLPTAAAPAQRLQAVLPEHVHPAGVLNILLI
EDHVDTAEVMAQLIRTLGHDVTTVGRVDDALAATQLQEFDLVISDVGLPDGTGLDFIMAY
REHWDAPAVALTGFGTDEDVRRCLAAGFTSHLTKPVNFAQLEAMIESAINLKARKQA