Protein Info for H281DRAFT_00875 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF00072: Response_reg" amino acids 71 to 146 (76 residues), 58.1 bits, see alignment E=4.7e-20

Best Hits

KEGG orthology group: None (inferred from 87% identity to bug:BC1001_1725)

Predicted SEED Role

"FOG: CheY-like receiver"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAU0 at UniProt or InterPro

Protein Sequence (167 amino acids)

>H281DRAFT_00875 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Paraburkholderia bryophila 376MFSha3.1)
MSHGETVSIILIEDDDGHATLVERNLRRAGISNGFVRFRDGQQALDYFFGTDAADGAAAA
GGSVASRHANAEDLRNSVVLLDLKMPRVDGFEVLRRLKESPHTAPVPVIVLTTTDDPREI
ARCYELGCNVYITKPVEYDAFIEAVRRLGFFLQVVKLPSGHRFTASS