Protein Info for H281DRAFT_00869 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative ABC transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details TIGR00245: TIGR00245 family protein" amino acids 8 to 253 (246 residues), 218.5 bits, see alignment E=5e-69 PF03649: UPF0014" amino acids 9 to 249 (241 residues), 303.7 bits, see alignment E=4.4e-95

Best Hits

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 95% identity to bxe:Bxe_A2323)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MC76 at UniProt or InterPro

Protein Sequence (268 amino acids)

>H281DRAFT_00869 putative ABC transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MTLQNLSLWDVAIAALLIVVNGAVSVALKLDLERKLAWAAVRTVVQLLAIGYVLGWVFRY
DHWFVVLPLMTVMTLIAGFAGAQRGSRTYAGQRADSVLSIWVSSWLVAAVGLFVVIRIHP
WYEPQYAIPILGMILGNTLTGVSLGIERMTEELTARRDRVEMALALGATRWEAAQAPARQ
AVRAGMMPTLNQMAVVGVVSLPGMMTGQVLAGQSPLQAVRYQIVIMFLIAASSALGTVGA
VLLTYRRLFSAEHRFLSARLIERAGVRR