Protein Info for H281DRAFT_00867 in Paraburkholderia bryophila 376MFSha3.1

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 2 to 338 (337 residues), 498.2 bits, E=7e-154
• PF08240: ADH_N
  • amino acids 32 to 92 (61 residues), 34.4 bits, E=3.4e-12
• PF00107: ADH_zinc_N
  • amino acids 161 to 259 (99 residues), 51 bits, E=3e-17
• PF02254: TrkA_N
  • amino acids 161 to 257 (97 residues), 23.1 bits, E=1.5e-08
• PF13602: ADH_zinc_N_2
  • amino acids 194 to 335 (142 residues), 71.7 bits, E=2.5e-23

Best Hits

Swiss-Prot: 48% identical to ZDH1_STAAS: Zinc-type alcohol dehydrogenase-like protein SAS2087 (SAS2087) from Staphylococcus aureus (strain MSSA476)

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_1732)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See A0A2Z5MCQ5 at UniProt or InterPro

Protein Sequence (338 amino acids)

>H281DRAFT_00867 zinc-binding alcohol dehydrogenase family protein (Paraburkholderia bryophila 376MFSha3.1)
MKAVGLYRYLPIDQDEALIDVDIPKPEATGRDLLVKVEAISVNPVDTKVRAPKDTVEKAP
RVLGWDAAGTVVAAGPDVTLFKVGDPVFYAGSITRPGANSEFHLVDERIVGRKPASLDFT
HAAALPLTAITAWEALFDRLGVSPQGAHEGRTVLIFGGAGGVGSIGIQLAKQLAKLTVIA
TASRPESAKWATELGADHVVDHFGDMPAQLKKLGIEQVDYVLMFNDTDKNFPIAAELIKP
QGGICTIVENSKPVPVELLKAKSAAFHWEFMFTRSMFGTPDMIEQHKLLTEVARLVDAGT
LRTTVGQHLGAINAANLRRAHALLEEGRAIGKLVLTGF