Protein Info for H281DRAFT_00862 in Paraburkholderia bryophila 376MFSha3.1

Annotation: DNA end-binding protein Ku

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02772: Ku protein" amino acids 3 to 265 (263 residues), 334.1 bits, see alignment E=2.9e-104 PF02735: Ku" amino acids 11 to 195 (185 residues), 166.1 bits, see alignment E=4.5e-53

Best Hits

Swiss-Prot: 55% identical to KU_PSESM: Non-homologous end joining protein Ku (ku) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 89% identity to bgf:BC1003_1568)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAT0 at UniProt or InterPro

Protein Sequence (342 amino acids)

>H281DRAFT_00862 DNA end-binding protein Ku (Paraburkholderia bryophila 376MFSha3.1)
MAHMIWKGAISFGLVHVPVQLYPATKSEKVGFNLLDKRTIDPVGYKQINKRTGKDVTRDN
IVRGFEYEKDKYVVLTDDEIRAANPESTQTVDILAFVDAPDISFLYLDTPYFLTPDRKGE
KVYALLREAMKSSGKVGVASVVLHNKQHLAALIPVGPVLALNTLRWAEEVRDFDEFKLPA
EGTKAAGVSARELDMAQKLIDDMSDTWDPSKYHDTFRDDIMALVDRKVREGKTEEITDIE
APRESRQSADILDLSDLLKRSLGRGKSKPASGTRKRAAADETADEDSDSQEDSGSTASRK
KPRTTRSTRAPRSSGSGTSSGSGGGRATAKSTTTARKRRAAA