Protein Info for H281DRAFT_00859 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cystathionine beta-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF01053: Cys_Met_Meta_PP" amino acids 11 to 390 (380 residues), 300.3 bits, see alignment E=7.9e-94 TIGR01324: cystathionine beta-lyase" amino acids 12 to 392 (381 residues), 408.6 bits, see alignment E=1e-126

Best Hits

Swiss-Prot: 44% identical to METC_RHIL3: Putative cystathionine beta-lyase (metC) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 95% identity to bug:BC1001_1739)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAS6 at UniProt or InterPro

Protein Sequence (394 amino acids)

>H281DRAFT_00859 cystathionine beta-lyase (Paraburkholderia bryophila 376MFSha3.1)
MTQSKLKRSLQTRIVHAEDKLTPGFESFSMPVTRASTVVFPDLATMRALDWKNDAQWRYG
LHATPTSLALAQRLATIEGGNHALLQPSGLSSISNVYFGLVKAGDDVLIPDNVYSPNRDH
GDWLARDFGVTVRYYDPMIGAGIAELIQPNTRLIWLEAPGSVTMEVADVPAITAAARARN
VVTAIDNTWSAGLGFRPFDHGVDISVQALTKYQSGGGDVLMGATITVDRELHLKLKAARM
RMGIGVSSDDCSLILRSLPTMQVRFQQHDRSALALAQWLKTRPEIAAVLHPAIEDCPGHE
FFKRDFTGAGGLFSVVFDGRYSAAQIDTFCESLELFAIGWSWGGAHSLVMPYDIASMRTE
GEWPHRGTLVRFYIGLEEEADLRADIEQCLAALA