Protein Info for H281DRAFT_00844 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RNA polymerase, sigma 38 subunit, RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 70 to 358 (289 residues), 461.3 bits, see alignment E=1.3e-142 PF00140: Sigma70_r1_2" amino acids 79 to 112 (34 residues), 31.3 bits, see alignment 3.3e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 112 to 346 (235 residues), 114.3 bits, see alignment E=4.3e-37 PF04542: Sigma70_r2" amino acids 117 to 186 (70 residues), 77 bits, see alignment E=1.6e-25 PF04539: Sigma70_r3" amino acids 197 to 278 (82 residues), 25.9 bits, see alignment E=1.7e-09 PF04545: Sigma70_r4" amino acids 293 to 345 (53 residues), 61.4 bits, see alignment 9e-21

Best Hits

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 98% identity to bug:BC1001_1798)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MA52 at UniProt or InterPro

Protein Sequence (359 amino acids)

>H281DRAFT_00844 RNA polymerase, sigma 38 subunit, RpoS (Paraburkholderia bryophila 376MFSha3.1)
MPKSKRRLPQAESETISDATSASVDESGASEAEEETVEERELDERQSAEEGGDAREGAAE
VVPDADDFRALLQAELTADTIQHYLNRISVKPLLTVEEEQKYSRLAKAGEFEARQVMIER
NLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIEKFDPTRGFRFSTYATWWIRQSIERA
IMNQARTVRLPVHVIRELNQVLRAKRHLEKNSMNSGEAAERRDASIDDIAYLTGKTTDEV
TDILALNEHTASLDAPLDLDPASSLLDLLSDDQSQSPDAEVQHRELETLTRAWLARLSDK
HRHVIERRFGLNHIEPATLEELADEMGLTRERVRQIQQEALVRLKRFFASNGVRKDAVL