Protein Info for H281DRAFT_00826 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 492 to 513 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 20 to 197 (178 residues), 30.3 bits, see alignment E=2.1e-11 PF07690: MFS_1" amino acids 25 to 420 (396 residues), 103.5 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: None (inferred from 88% identity to bxe:Bxe_A2365)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>H281DRAFT_00826 Arabinose efflux permease (Paraburkholderia bryophila 376MFSha3.1)
MSTAWPRTRWPGAEKLRGDVFPWVLAVVTGLDYFDNSIFSFFASYIAGGVNASPDELVWA
SSAYAVAAVLGILQQEWWVERFGYRRYVAGCMLFYAVGAVAAALCESSVELAFARGFQGY
FIGPMMGTCRILIQMSFTPKQRPAATRAFLILIVLSSALASLIGGQLVSYFGWRALFACT
APVGMLFMVLAVLALPDAGNRLPEERGSAHFWPYIVFAFAQGALQIVMQQVRFQLFSASP
GLILLTLAGIVALGWFAYHQWHHPAPLMRLHALREKVFQIGLVLYMFYYYLSTAFSYLIS
RLLESGLGYPIENAGQLVGVTSLISASALFIYLRFAKLLTRKKWIIVPGFGIAALTAAWM
TRMSPSVGEAALVGPLLLRGLLLLFIVLPVANLTFRIFAIEEFTHGYRLKNIVRQLTISF
ATASVIIVEQHRQAIHQARLAEFVNPYNPLFQDSLAALTRTLSAAGRSPSDAHSLALVEI
SRSVVRQASFLTSLDGFYFLIGIAICGGIFAAWQKQID