Protein Info for H281DRAFT_00816 in Paraburkholderia bryophila 376MFSha3.1
Annotation: transcriptional regulator, BadM/Rrf2 family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to NSRR_BACLD: HTH-type transcriptional regulator NsrR (nsrR) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 90% identity to bgf:BC1003_1526)Predicted SEED Role
"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (169 amino acids)
>H281DRAFT_00816 transcriptional regulator, BadM/Rrf2 family (Paraburkholderia bryophila 376MFSha3.1) MRLTDYTDYSLRVLLYLAVRGEGLSTIQDISQAYGISKNHLMKVVQQLSELGWVETVRGR NGGLRLAGRTRSLTVGEVVRATESDFALVACLPDQNGERRPCVITPQCRLRGALEAARHA FLAELDRHTIDEVAGPQGPLAALLGIRTVIPVVPLTPVTTASDKPVSIS